PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S22614.30
Common NameJCGZ_08226
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family E2F/DP
Protein Properties Length: 207aa    MW: 22854.2 Da    PI: 9.1763
Description E2F/DP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S22614.30genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1E2F_TDP23.78.1e-08172205134
        E2F_TDP   1 rkeksLrlltqkflkllekseegivtlnevakeL 34 
                    r+++sL+llt+kf+kl+++ ++g+++ln  a+ L
  Jcr4S22614.30 172 RYDSSLGLLTRKFVKLIQEDKDGTLDLNRTADVL 205
                    6899***************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.105.4E-7169207IPR011991Winged helix-turn-helix DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MAADWREDPS RTLNPSQCHF QLLNPHSQNH YHNQSPSTLC SSSSSSSPTL ANPAFISSFH  60
KPQYGHPSDN NKSNQLSNNI PFAFQLHAEE THSAFSKLAL KQTNEKVNHE AQYGGQEPFA  120
KHNKVPNHVL DPQSATRSKR INRAKVSKNG KLGIQGSNAE SPNGLNPATG CRYDSSLGLL  180
TRKFVKLIQE DKDGTLDLNR TADVLEV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012073814.11e-150PREDICTED: transcription factor E2FC isoform X2
TrEMBLA0A067KXD41e-150A0A067KXD4_JATCU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G47870.14e-17E2F/DP family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]